cancer lncRNA gene database (PCdb) Home
PCdb
cancer lncRNA database
General information | Expression | lncRNA | Regulation | Mutation | Homolog | Interaction

Basic Information

Gene ID

5243

Name

ABCB1

Synonym

ABC20|CD243|CLCS|GP170|MDR1|P-GP|PGY1;ATP-binding cassette, sub-family B (MDR/TAP), member 1;ABCB1;ATP-binding cassette, sub-family B (MDR/TAP), member 1

Definition

P-glycoprotein 1|colchicin sensitivity|doxorubicin resistance|multidrug resistance protein 1

Position

7q21.12

Gene Type

protein-coding

Pathways and Diseases

Pathway

multi-drug resistance factors;PID BioCarta;100103

Pathway

ABC transporters;KEGG PATHWAY;hsa02010

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Disease

tacrolimus dose requirements;GAD

Disease

heart transplant;GAD

Disease

inflammatory bowel disease;GAD

Disease

indinavir pharmacokinetics;GAD

Disease

steroid weaning;GAD

Disease

breast cancer;GAD

Disease

Alzheimer's disease;GAD

Disease

altered efflux of the P-glycoprotein substrate rhodamine;GAD

Disease

Crohn's disease;GAD

Disease

paclitaxel toxicity;GAD

Disease

Inflammatory bowel disease 13, susceptibility to;OMIM

Disease

fluvoxamine pharmacokinetics;GAD

Disease

tacrolimus pharmacokinetics;GAD

Disease

aldosterone blood pressure, arterial kidney function left ventricular function;GAD

Disease

cyclosporine nephrotoxicity;GAD

Disease

lung transplant complications;GAD

Disease

cyclosporine resistance;GAD

Disease

nasopharyngeal cancer;GAD

Disease

Crohn's disease ulcerative colitis;GAD

Disease

hypertension;GAD

Disease

docetaxel pharmacokinetics;GAD

Disease

fentanyl effects;GAD

Disease

HIV;GAD

Disease

ebastine metabolism;GAD

Disease

schizophrenia;GAD

Disease

PHARMACOGENOMIC;GAD

Disease

loperamide concentration;GAD

Disease

METABOLIC;GAD

Disease

amlodipine pharmacokinetics;GAD

Disease

kidney dysfunction;GAD

Disease

prolactin;GAD

Disease

tacrolimus pharmcokinetics;GAD

Disease

irinotecan pharmacokinetics irinotecan toxicity lung cancer;GAD

Disease

PSYCH;GAD

Disease

epilepsy phentoin levels;GAD

Disease

HIV Infections;GAD

Disease

CARDIOVASCULAR;GAD

Disease

digoxin, serum concentration;GAD

Disease

CANCER;GAD

Disease

epilpsy;GAD

Disease

simvastatin;GAD

Disease

major depression;GAD

Disease

epilepsy;GAD

Disease

cyclosporine pharmacokinetics;GAD

Disease

renal cancer;GAD

Disease

leukemia, acute myeloid;GAD

Disease

NEUROLOGICAL;GAD

Disease

IMMUNE;GAD

Disease

ulcerative colitis;GAD

Disease

cholesterol, LDL;GAD

Disease

cholesterol;GAD

Disease

antiemetic response;GAD

Disease

plasma cell myeloma;GAD

Disease

leukemia;GAD

Disease

liver cancer;GAD

Disease

renal function;GAD

Disease

methotrexate toxicity;GAD

Disease

liver transplant;GAD

Disease

Hypotension;GAD

Disease

INFECTION;GAD

Disease

Colchicine resistance;OMIM

Disease

lung cancer;GAD

Disease

ovarian cancer;GAD

Disease

pravastatin kinetics;GAD

Disease

RENAL;GAD

External Links

Links to Entrez Gene

5243

Links to all GeneRIF Items

5243

Links to iHOP

5243

Sequence Information

Nucleotide Sequence

>5243 : length: 4718
AAACACTTGTATTACCATTTTAAAGGCTATCATTACTCTTTACCTGTGAAGAGTAGAACA
TGAAGAAATCTACTTTATTCAGATATTCTCCAGATTCCTAAAGATTAGAGATCATTTCTC
ATTCTCCTAGGAGTACTCACTTCAGGAAGCAACCAGATAAAAGAGAGGTGCAACGGAAGC
CAGAACATTCCTCCTGGAAATTCAACCTGTTTCGCAGTTTCTCGAGGAATCAGCATTCAG
TCAATCCGGGCCGGGAGCAGTCATCTGTGGTGAGGCTGATTGGCTGGGCAGGAACAGCGC
CGGGGCGTGGGCTGAGCACAGCCGCTTCGCTCTCTTTGCCACAGGAAGCCTGAGCTCATT
CGAGTAGCGGCTCTTCCAAGCTCAAAGAAGCAGAGGCCGCTGTTCGTTTCCTTTAGGTCT
TTCCACTAAAGTCGGAGTATCTTCTTCCAAAATTTCACGTCTTGGTGGCCGTTCCAAGGA
GCGCGAGGTCGGAATGGATCTTGAAGGGGACCGCAATGGAGGAGCAAAGAAGAAGAACTT
TTTTAAACTGAACAATAAAAGTGAAAAAGATAAGAAGGAAAAGAAACCAACTGTCAGTGT
ATTTTCAATGTTTCGCTATTCAAATTGGCTTGACAAGTTGTATATGGTGGTGGGAACTTT
GGCTGCCATCATCCATGGGGCTGGACTTCCTCTCATGATGCTGGTGTTTGGAGAAATGAC
AGATATCTTTGCAAATGCAGGAAATTTAGAAGATCTGATGTCAAACATCACTAATAGAAG
TGATATCAATGATACAGGGTTCTTCATGAATCTGGAGGAAGACATGACCAGGTATGCCTA
TTATTACAGTGGAATTGGTGCTGGGGTGCTGGTTGCTGCTTACATTCAGGTTTCATTTTG
GTGCCTGGCAGCTGGAAGACAAATACACAAAATTAGAAAACAGTTTTTTCATGCTATAAT
GCGACAGGAGATAGGCTGGTTTGATGTGCACGATGTTGGGGAGCTTAACACCCGACTTAC
AGATGATGTCTCCAAGATTAATGAAGGAATTGGTGACAAAATTGGAATGTTCTTTCAGTC
AATGGCAACATTTTTCACTGGGTTTATAGTAGGATTTACACGTGGTTGGAAGCTAACCCT
TGTGATTTTGGCCATCAGTCCTGTTCTTGGACTGTCAGCTGCTGTCTGGGCAAAGATACT
ATCTTCATTTACTGATAAAGAACTCTTAGCGTATGCAAAAGCTGGAGCAGTAGCTGAAGA
GGTCTTGGCAGCAATTAGAACTGTGATTGCATTTGGAGGACAAAAGAAAGAACTTGAAAG
GTACAACAAAAATTTAGAAGAAGCTAAAAGAATTGGGATAAAGAAAGCTATTACAGCCAA
TATTTCTATAGGTGCTGCTTTCCTGCTGATCTATGCATCTTATGCTCTGGCCTTCTGGTA
TGGGACCACCTTGGTCCTCTCAGGGGAATATTCTATTGGACAAGTACTCACTGTATTCTT
TTCTGTATTAATTGGGGCTTTTAGTGTTGGACAGGCATCTCCAAGCATTGAAGCATTTGC
AAATGCAAGAGGAGCAGCTTATGAAATCTTCAAGATAATTGATAATAAGCCAAGTATTGA
CAGCTATTCGAAGAGTGGGCACAAACCAGATAATATTAAGGGAAATTTGGAATTCAGAAA
TGTTCACTTCAGTTACCCATCTCGAAAAGAAGTTAAGATCTTGAAGGGTCTGAACCTGAA
GGTGCAGAGTGGGCAGACGGTGGCCCTGGTTGGAAACAGTGGCTGTGGGAAGAGCACAAC
AGTCCAGCTGATGCAGAGGCTCTATGACCCCACAGAGGGGATGGTCAGTGTTGATGGACA
GGATATTAGGACCATAAATGTAAGGTTTCTACGGGAAATCATTGGTGTGGTGAGTCAGGA
ACCTGTATTGTTTGCCACCACGATAGCTGAAAACATTCGCTATGGCCGTGAAAATGTCAC
CATGGATGAGATTGAGAAAGCTGTCAAGGAAGCCAATGCCTATGACTTTATCATGAAACT
GCCTCATAAATTTGACACCCTGGTTGGAGAGAGAGGGGCCCAGTTGAGTGGTGGGCAGAA
GCAGAGGATCGCCATTGCACGTGCCCTGGTTCGCAACCCCAAGATCCTCCTGCTGGATGA
GGCCACGTCAGCCTTGGACACAGAAAGCGAAGCAGTGGTTCAGGTGGCTCTGGATAAGGC
CAGAAAAGGTCGGACCACCATTGTGATAGCTCATCGTTTGTCTACAGTTCGTAATGCTGA
CGTCATCGCTGGTTTCGATGATGGAGTCATTGTGGAGAAAGGAAATCATGATGAACTCAT
GAAAGAGAAAGGCATTTACTTCAAACTTGTCACAATGCAGACAGCAGGAAATGAAGTTGA
ATTAGAAAATGCAGCTGATGAATCCAAAAGTGAAATTGATGCCTTGGAAATGTCTTCAAA
TGATTCAAGATCCAGTCTAATAAGAAAAAGATCAACTCGTAGGAGTGTCCGTGGATCACA
AGCCCAAGACAGAAAGCTTAGTACCAAAGAGGCTCTGGATGAAAGTATACCTCCAGTTTC
CTTTTGGAGGATTATGAAGCTAAATTTAACTGAATGGCCTTATTTTGTTGTTGGTGTATT
TTGTGCCATTATAAATGGAGGCCTGCAACCAGCATTTGCAATAATATTTTCAAAGATTAT
AGGGGTTTTTACAAGAATTGATGATCCTGAAACAAAACGACAGAATAGTAACTTGTTTTC
ACTATTGTTTCTAGCCCTTGGAATTATTTCTTTTATTACATTTTTCCTTCAGGGTTTCAC
ATTTGGCAAAGCTGGAGAGATCCTCACCAAGCGGCTCCGATACATGGTTTTCCGATCCAT
GCTCAGACAGGATGTGAGTTGGTTTGATGACCCTAAAAACACCACTGGAGCATTGACTAC
CAGGCTCGCCAATGATGCTGCTCAAGTTAAAGGGGCTATAGGTTCCAGGCTTGCTGTAAT
TACCCAGAATATAGCAAATCTTGGGACAGGAATAATTATATCCTTCATCTATGGTTGGCA
ACTAACACTGTTACTCTTAGCAATTGTACCCATCATTGCAATAGCAGGAGTTGTTGAAAT
GAAAATGTTGTCTGGACAAGCACTGAAAGATAAGAAAGAACTAGAAGGTTCTGGGAAGAT
CGCTACTGAAGCAATAGAAAACTTCCGAACCGTTGTTTCTTTGACTCAGGAGCAGAAGTT
TGAACATATGTATGCTCAGAGTTTGCAGGTACCATACAGAAACTCTTTGAGGAAAGCACA
CATCTTTGGAATTACATTTTCCTTCACCCAGGCAATGATGTATTTTTCCTATGCTGGATG
TTTCCGGTTTGGAGCCTACTTGGTGGCACATAAACTCATGAGCTTTGAGGATGTTCTGTT
AGTATTTTCAGCTGTTGTCTTTGGTGCCATGGCCGTGGGGCAAGTCAGTTCATTTGCTCC
TGACTATGCCAAAGCCAAAATATCAGCAGCCCACATCATCATGATCATTGAAAAAACCCC
TTTGATTGACAGCTACAGCACGGAAGGCCTAATGCCGAACACATTGGAAGGAAATGTCAC
ATTTGGTGAAGTTGTATTCAACTATCCCACCCGACCGGACATCCCAGTGCTTCAGGGACT
GAGCCTGGAGGTGAAGAAGGGCCAGACGCTGGCTCTGGTGGGCAGCAGTGGCTGTGGGAA
GAGCACAGTGGTCCAGCTCCTGGAGCGGTTCTACGACCCCTTGGCAGGGAAAGTGCTGCT
TGATGGCAAAGAAATAAAGCGACTGAATGTTCAGTGGCTCCGAGCACACCTGGGCATCGT
GTCCCAGGAGCCCATCCTGTTTGACTGCAGCATTGCTGAGAACATTGCCTATGGAGACAA
CAGCCGGGTGGTGTCACAGGAAGAGATTGTGAGGGCAGCAAAGGAGGCCAACATACATGC
CTTCATCGAGTCACTGCCTAATAAATATAGCACTAAAGTAGGAGACAAAGGAACTCAGCT
CTCTGGTGGCCAGAAACAACGCATTGCCATAGCTCGTGCCCTTGTTAGACAGCCTCATAT
TTTGCTTTTGGATGAAGCCACGTCAGCTCTGGATACAGAAAGTGAAAAGGTTGTCCAAGA
AGCCCTGGACAAAGCCAGAGAAGGCCGCACCTGCATTGTGATTGCTCACCGCCTGTCCAC
CATCCAGAATGCAGACTTAATAGTGGTGTTTCAGAATGGCAGAGTCAAGGAGCATGGCAC
GCATCAGCAGCTGCTGGCACAGAAAGGCATCTATTTTTCAATGGTCAGTGTCCAGGCTGG
AACAAAGCGCCAGTGAACTCTGACTGTATGAGATGTTAAATACTTTTTAATATTTGTTTA
GATATGACATTTATTCAAAGTTAAAAGCAAACACTTACAGAATTATGAAGAGGTATCTGT
TTAACATTTCCTCAGTCAAGTTCAGAGTCTTCAGAGACTTCGTAATTAAAGGAACAGAGT
GAGAGACATCATCAAGTGGAGAGAAATCATAGTTTAAACTGCATTATAAATTTTATAACA
GAATTAAAGTAGATTTTAAAAGATAAAATGTGTAATTTTGTTTATATTTTCCCATTTGGA
CTGTAACTGACTGCCTTGCTAAAAGATTATAGAAGTAGCAAAAAGTATTGAAATGTTTGC
ATAAAGTGTCTATAATAAAACTAAACTTTCATGTGAAA

Protein Sequence

>5243 : length: 1280
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ



')