cancer lncRNA gene database (PCdb) Home
PCdb
cancer lncRNA database
General information | Expression | lncRNA | Regulation | Mutation | Homolog | Interaction

Basic Information

Gene ID

10006

Name

ABI1

Synonym

ABI-1|ABLBP4|E3B1|NAP1BP|SSH3BP|SSH3BP1;abl-interactor 1;ABI1;abl-interactor 1

Definition

Abelson interactor 1|Abl-interactor protein 1 long|abl interactor 1|abl-binding protein 4|eps8 SH3 domain-binding protein|interactor protein AblBP4|nap1 binding protein|spectrin SH3 domain-binding protein 1

Position

10p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

E-cadherin signaling in the nascent adherens junction;PID Curated;200105

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

RAC1 signaling pathway;PID Curated;200190

Pathway

Regulation of RAC1 activity;PID Curated;200165

Pathway

ErbB1 downstream signaling;PID Curated;200113

Disease

Leukemia;FunDO

Disease

Breast cancer;FunDO

External Links

Links to Entrez Gene

10006

Links to all GeneRIF Items

10006

Links to iHOP

10006

Sequence Information

Nucleotide Sequence

>10006 : length: 3725
GAGAAATAAACGCTCGCGAGAGAACGAGGTTCAGGCGGCTGCACGAAGGGGGTGGAGGGG
GGCTGGAGAGAGTGAGGAGGAAGGGGAGGAGGTGCCGTCCCACAATACCAGGCGGGAGGG
CGGGTAGGCGGTTTGTATCCGGGCTGTGAGGTGCTCGGAGCCTCGGCGGACCTTGCTGCC
TCTGTCTCTTTAACGCGAGAGGAAGCGATGCAGAGGGGTGGAAAATGGCAGAGCTGCAGA
TGTTACTAGAGGAGGAGATCCCGTCTGGCAAGAGGGCGCTGATCGAGAGTTACCAGAACC
TGACTCGGGTGGCAGACTACTGTGAAAACAACTACATACAGGCTACAGACAAGAGAAAAG
CTTTAGAGGAGACCAAAGCCTATACAACCCAATCTCTAGCTAGTGTTGCTTATCAAATAA
ATGCATTGGCCAACAATGTACTCCAGTTGCTGGATATCCAAGCCTCTCAGCTTCGGAGAA
TGGAGTCTTCCATCAATCATATCTCACAGACTGTGGATATTCATAAGGAGAAAGTGGCAC
GAAGAGAGATTGGTATTTTGACAACAAATAAGAATACATCAAGAACTCACAAAATAATAG
CACCTGCGAATATGGAGCGCCCTGTAAGGTATATTCGGAAACCTATCGATTACACAGTTC
TGGATGATGTGGGCCATGGTGTCAAGTGGCTAAAAGCCAAGCATGGAAATAACCAGCCTG
CAAGAACTGGCACACTGTCGAGAACAAATCCTCCTACTCAGAAACCGCCAAGTCCTCCCA
TGTCAGGCCGGGGAACACTGGGACGGAATACTCCTTATAAAACCCTGGAACCTGTTAAAC
CCCCAACAGTTCCTAATGACTATATGACCAGTCCTGCTAGGCTTGGAAGTCAGCATAGTC
CAGGCAGGACAGCATCTTTAAATCAGAGACCAAGGACACACAGTGGAAGTAGTGGAGGAA
GTGGAAGTCGAGAAAACAGTGGTAGCAGTAGTATTGGCATTCCCATTGCTGTGCCTACAC
CTTCGCCACCCACTATTGGACCAGAAAACATTTCTGTCCCTCCTCCTTCTGGAGCTCCAC
CAGCACCACCTCTGGCACCACTTCTCCCAGTGAGCACTGTGATAGCAGCCCCGGGCTCAG
CTCCTGGTTCCCAGTATGGCACAATGACCAGGCAGATATCTCGACACAACTCTACTACTT
CTTCGACATCTTCTGGTGGATACAGACGAACTCCCTCTGTGACTGCTCAATTTTCTGCTC
AGCCTCATGTTAATGGAGGTCCACTTTATTCTCAAAATTCAATTTCTATTGCTCCACCCC
CTCCCCCTATGCCTCAGTTGACTCCACAGATACCTCTCACAGGCTTCGTGGCCAGGGTGC
AGGAAAACATTGCTGATAGTCCAACTCCACCGCCACCACCTCCACCAGATGACATTCCCA
TGTTTGATGACTCTCCACCTCCCCCACCACCACCACCAGTGGATTATGAAGATGAGGAGG
CTGCAGTAGTTCAGTATAATGATCCATATGCAGATGGGGATCCTGCTTGGGCCCCCAAGA
ATTATATTGAGAAAGTTGTTGCAATATATGATTATACAAAAGACAAGGATGATGAGCTGT
CATTTATGGAGGGTGCAATCATTTATGTTATAAAGAAGAATGATGATGGCTGGTATGAAG
GAGTCTGCAATCGAGTGACTGGTCTGTTCCCTGGGAACTATGTTGAATCAATCATGCACT
ATACTGATTAATTTTTTTTTTTCTTTTGAAGTAGATTCTTATTACTCAGTCATACTGTGG
GACTATTATGGTTAACAGAACTGTCTTAATATGTTTTAAAATGTGCCCATATTTTCAGAA
CATGCTGTTTTATTGGTAAATTGAATGTCTACCTGTAAGCATAAATCTTTGAGGCAGTTT
ATGTATTGCTGAATAGCAATTTATACAAGAAGCTGTCCATAACTGATTATGCTTATGTAC
TTACTTACACATTTTTAACTTTATGACCAGCCTAAATATTCTGGGGGAAGTGGGGTATAA
TATTTAACGAATCATGATTCAGATTGTACCATTACATGTTTCAGTGCAGCATGGTTACTA
ACGCTATGTCAGACTAATATTAAAATCAGAAAATTTAAATGCTGGTGCTGGTCAGACTTT
TTTTGTTAGATTCTCTCATTTAAAAAAAATACTGTTTGTTTAAAGCATGCATAAAAATTT
ATGTATTGAAATATACTTAAAAATTCAAGATGCTTCCCATTTGTGTAATATTTACCTGGA
GGACTCGTACTTAGGTGTCTTAACGTGAATTGAGTCTCCAAGGTCTCCATGTGAAACAAG
CAAAAAGAGAATTATCTGTAATGTTGTAATTTGTACCTAAGTTTTTTAATGAGTGAAATT
TGCATTATAAACTTTTTCCATTCATAAATACATAAGTGAACCAAAGGTTTTTGTCCTTTC
CTTCACTGATTTGCTTTAAAAAAAATAAAAGATAATGATTTATTGCAGAATTATGATTCT
ATTTTCTCAATATGTTAACTTGGAAAAAAATTTTAGCCTTATCTTAATCTGTCCCAACAG
CAATGTGACGGATTTTTGCAGATTCAAAATCTGCAATGGTTATTTACAAGTCAATCTACT
GAATTCCTTTTTTAAATAATCTTTTGAAACTAAGAAAATGTGTCAAATTGTGTGCATTCA
TTCTGTAGGTAAAATTCTTAAGGATTGCCATGTCAGTCCTTCAGTTGTACAGTGAACTGT
TGTACACTGGTTCAATGAAAGGAAGTTAAAAGTACCTTTTACATATTGTAAAAGTGGATA
CAGTTGATTTGTGAGTAGGCACTCTTTAATCCATTACCTGGCACTAGCAACATTAGAATT
TTAAAATAAAATAATTGGGAAAGAAGGTGGGTCATGTATTAATCAGTGAACAGAGATTTA
CCTAACCAACAGACTTGGATTGTCTTTTGACATAATCAAAATGCAACACATGCACTTTGT
GTGTCTCCTCTTAATTGAAGGGAGGGCTGAGGGATGTTTTCTCTTCTTGTCTTGTGTATA
ATTCTCTATTGCTTAGGATATTAAAGTAGAGCACTCAAGTGTGGGTTTCTGTGTTATTGA
GGATTTGTTTGGAATTCAAATTACAGTTATGTACTGGATGCTACAGACTTATAACAGCAT
AGTGAATGGTAAGACTAGTGCAAAACAGTTATTTCTGAAAATTAAAGACCATTATTGCTA
CCAAATCAATGTGACTATTTCATATGCATTTTGCCTTTGTTAATTTTAAACAAACAAAGT
ATCATTAGTGATCAGCTAGCTACCTTCTACTTTCCATTTTTCAAGTGGATTGTTCTCTTA
ATTTGTATATAACCTGTTGTCTAAATTTTATGTACAGTCTTTTATAATAAACCATTCTCC
TATATGAAATTTTGGATACTGTTAAAATATAACTCATGTGGACTTCAATGCAGACTTCAC
ATTTTTCTGACCTTTACTCCTACGGTAAATCAAGACAAACCATTTGAATTTTAACATTGG
TTATTTATTTGTGTAATGGCCTTACATGTGGATATTAACAGTGTAAACAATACCACATAT
AACCATCAAGATACCTTGATTATAATTTATAGGACTAGAATGACAGATTCAGGTGGTTTA
TTAATTACATTTAAAAAGTTTTCTGAAAAAACTTTTGCAATAAAAAAAAATAAATTGCCC
ATCAA

Protein Sequence

>10006 : length: 508
MAELQMLLEEEIPSGKRALIESYQNLTRVADYCENNYIQATDKRKALEETKAYTTQSLAS
VAYQINALANNVLQLLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSR
THKIIAPANMERPVRYIRKPIDYTVLDDVGHGVKWLKAKHGNNQPARTGTLSRTNPPTQK
PPSPPMSGRGTLGRNTPYKTLEPVKPPTVPNDYMTSPARLGSQHSPGRTASLNQRPRTHS
GSSGGSGSRENSGSSSIGIPIAVPTPSPPTIGPENISVPPPSGAPPAPPLAPLLPVSTVI
AAPGSAPGSQYGTMTRQISRHNSTTSSTSSGGYRRTPSVTAQFSAQPHVNGGPLYSQNSI
SIAPPPPPMPQLTPQIPLTGFVARVQENIADSPTPPPPPPPDDIPMFDDSPPPPPPPPVD
YEDEEAAVVQYNDPYADGDPAWAPKNYIEKVVAIYDYTKDKDDELSFMEGAIIYVIKKND
DGWYEGVCNRVTGLFPGNYVESIMHYTD



')